DPCstruct | MC704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 7.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.76 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF05427- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1SLB5 | 83-146 | QNKLKSTQRDKVKKFISLTQTGEQTAIYCLQQNDWKLDLASDNYFQNPEYYYRELDRKRIEQLF |
| A0A433CWN3 | 1-83 | MFSTNSLKSSQKEKVKQFMTFTNASEKIAIKTLRDHSWNTEQAVDSYFNDPSAISPVSPAVAQTGSFDQRKLQALFDKYKGQT |
| A0A7J5Y289 | 1-72 | None |
| A0A7J7QIQ0 | 8-96 | None |
| A0A7R8ZZI0 | 619-687 | None |
| A0A668RER3 | 352-419 | None |
| G5B5Q2 | 1-72 | None |
| A0A673LQ28 | 12-84 | None |
| A0A0S7G846 | 40-118 | None |
| H2ZKA2 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.