DPCstruct | MC7038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Standard deviation of domain lengths | 10.89 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0404 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U2S863 | 226-342 | LHSIAALGKLYSEVIEGIDPGPIEAIRATGANWLQVVRYAVIPQIIPPFTAFTIYRWDINVRSATVIGLVGGGGIGFLLIELIRVNN… |
| A0A2A7QM46 | 2-89 | GANYFQIIVFAVLPQVIENFISYFLYTFEINVRASTVLGYLGAGGIGMLLQQSLDSFDYSQTAVIILATLIVVLVIDGLSNYLREKLD |
| A0A5D5AVC2 | 122-210 | None |
| A0A132C243 | 50-145 | None |
| A0A3B0SQ38 | 697-811 | None |
| A0A090SVS2 | 88-183 | None |
| A0A5N7ZIA5 | 164-259 | None |
| A0A7Y3AK39 | 131-227 | None |
| A0A136KXJ5 | 572-688 | None |
| A0A1Q3DQE1 | 2-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.