DPCstruct | MC7036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 643 |
|---|---|
| Mean domain length (aa) | 354 ± 72 aa |
| Standard deviation of domain lengths | 71.59 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 13.30 |
| Pfam Score | 99.35 |
| Assigned Pfam label(s) | CL0023- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286TXT5 | 2-338 | YMIGKTGVGKSTLIENMITSDIKEGHGVALIDPHGDLAESILNFVPESRIQDVIYFNPADIEYPIAFNPLEDVHQDFHHLVSSSFIS… |
| A0A429IDC4 | 98-377 | VRANRRAEGPLVVATTDPALWADTKDARAKLGPLLTYDPQHLLDTPARLRWSPTSGCEDIAVAAERAAALLTPVRPSSVLDSAVADS… |
| A0A497P3Q9 | 302-650 | None |
| A0A263DNR9 | 143-484 | None |
| A0A7X4KZL7 | 78-414 | None |
| A0A4R4D2W5 | 61-496 | None |
| A0A1Q9BXG5 | 5-369 | None |
| A0A7J3G6U6 | 6-285 | None |
| E6N6S2 | 66-362 | None |
| A0A4S2MS22 | 191-597 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.