DPCstruct | MC7035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 412 ± 78 aa |
| Standard deviation of domain lengths | 77.84 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2U7Z8 | 84-540 | GFYVIHAGLLILFMGSFFTYINGVDGILQLLPNTPASSVSLSEDILKVDFQNLQKSFQMPLPYKPGKTKLDTTIEKVVKVKSFIPFA… |
| A0A286TU70 | 62-506 | IIEKHPPKYKLITYVKDKDKQKAVPAKVGKRISVPGSNYAVTVKDFISDAEIQHEPINLSDKPDNPALYIQLAENDQVTAEGWLLAK… |
| A0A090WXP4 | 127-479 | None |
| A0A7Y5HG17 | 494-906 | None |
| A0A838EYU4 | 1-421 | None |
| A0A832M674 | 272-778 | None |
| A0A7V8BF16 | 2-349 | None |
| A0A090W6A8 | 85-464 | None |
| A0A2D5BVN1 | 171-756 | None |
| A0A2V5NGH2 | 124-627 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.