DPCstruct | MC7034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 266 ± 38 aa |
| Standard deviation of domain lengths | 37.90 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M6K8N5 | 1-303 | MTLDLKQLESKDFLEKTKILTQDIISEDRFRKAYDLAKELEQSTEAIKDFKEKNYELYREYKNIIIKLYWLGLPIMTEDRVIHMFRH… |
| A0A1G2FIX0 | 5-229 | KLLTQEQLKDPTIFEKIRRLTEDIVWHILTKEAYNLALNLEKSLEAANLKAIAPKLTQEYESIIIRLKLTALPMLSDEESVKIVREH… |
| A0A1F5PML4 | 13-313 | None |
| A0A1F5SX98 | 74-327 | None |
| A0A2M7H274 | 11-301 | None |
| A0A0G0F869 | 2-230 | None |
| K2FQ75 | 4-213 | None |
| A0A0G1QWD7 | 12-249 | None |
| A0A0G1V3K4 | 1-262 | None |
| A0A1F5P833 | 2-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.