DPCstruct | MC7033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 182 ± 17 aa |
| Standard deviation of domain lengths | 17.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G5ICJ8 | 2-150 | NRIEARLYVINSQTFKKELKSIQAYYCDSCKRYYVLDSEYQKLISCGVPCCQIINISDIRSGKYDRWKKTSTLRLYGYNVNKQENLS… |
| A0A1C5W2Q9 | 184-365 | HLLDIHSKITLQVKGTTTSCINKKHTTSDITVQIPVIYESGDIGFEISHAIYCHQCDAYIILKSDFDKINGVILCKVIDETFESKPI… |
| A0A315ZPH2 | 145-318 | None |
| A0A1Q9K6I6 | 140-318 | None |
| A0A099S1N8 | 86-276 | None |
| A0A285T8K6 | 209-401 | None |
| A0A1M5X0D5 | 79-280 | None |
| A0A413PDX6 | 243-419 | None |
| A0A6F9YBG1 | 375-577 | None |
| R7NCL5 | 230-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.