DPCstruct | MC7028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9E042 | 4-85 | PASGERYEAQVCAGPGGVMTVEVGCITGDLTVVTTGLPDGRAWVAIQYRGADEWYTLDGTPLFPPAGQSLAAYHQRVVEAVE |
| A0A839JHN7 | 1-66 | MTQHFTAPPGGIMTDDVGVITGPVEARIDGDLVRIRYEGAGEEYTVTGTVGERTPDEVWEQLTTDP |
| A0A6J4R8M8 | 6-92 | None |
| A0A2T0U896 | 1-92 | None |
| A0A1C4TWQ9 | 60-146 | None |
| A0A1H2CY52 | 15-98 | None |
| A0A7K2NJN7 | 9-88 | None |
| A0A7W7GTA0 | 44-123 | None |
| A0A387HQH8 | 4-83 | None |
| A0A5C5R6Z7 | 6-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.