DPCstruct | MC7024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 75 ± 15 aa |
| Standard deviation of domain lengths | 15.03 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A2GC10 | 15-74 | LAPAPAPPLAPPSCQPVSKAGNCYRPGQYCRNSDHGVTGVGEGGQEIVCTDNDGWRWERA |
| A0A1L9DFB4 | 3-70 | TAQPPTDPETQRTQAAAGGSGCEIRSNAGNCYAAGQFCRNDDLGRSTHDANGRVIYCRVVSGKPHWQA |
| A0A0F4JMJ6 | 115-184 | None |
| B4VD40 | 16-83 | None |
| A0A3R7I971 | 175-254 | None |
| A0A399GZ33 | 187-273 | None |
| A0A542UFS0 | 272-346 | None |
| A0A1I2PGX1 | 143-209 | None |
| A0A7W3XXI9 | 11-94 | None |
| A0A0F4JUP8 | 77-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.