DPCstruct | MC7023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 147 ± 10 aa |
| Standard deviation of domain lengths | 10.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 38.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1CGR9 | 307-470 | LETHLPQIDPMFLQIKMDPDPSNWPMLFETVIPLMGTQERRLYFRGIQQQHGSDDNSIYLVRGFVESIVEPQGGFPGWRRFCFAIYD… |
| A0A3A3A1E8 | 1-155 | MCMQSLQIKPHPDPTNWPALFDEIISILGTSADRVYFRGIQGINEDSTNLIRGFIEPIMQQQGEFSGWKRICFAIYKPNSMNLGSTE… |
| J3KD16 | 181-323 | None |
| A0A146FI64 | 247-378 | None |
| A0A5N6HXL1 | 2-154 | None |
| A0A0J8TF65 | 282-422 | None |
| S8B5G2 | 284-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.