DPCstruct | MC7022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Standard deviation of domain lengths | 5.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z2JGD5 | 7-67 | IAYRKKKKESQRRFWARFGVTQSRGSRFESGAEIPPPVSILLGLYFNKTISDGDLGRAERV |
| A0A418Y7H8 | 6-61 | LKRFRVGKRESQEKFWGRFGVTQSSGSRFETGLGIPAPVAILVKLYLNGKLTDGDL |
| A0A516SM42 | 3-54 | None |
| A0A4Y9T0Z3 | 41-103 | None |
| A0A2D2DVK9 | 2-51 | None |
| A0A4Q6GE47 | 34-88 | None |
| A0A557QSJ7 | 25-90 | None |
| A0A7R6R0B1 | 15-74 | None |
| A0A2G8TI69 | 37-91 | None |
| A0A1G3HSH1 | 19-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.