DPCstruct | MC7021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 7.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5J821 | 30-116 | DIALDMVGKLPEVKKFVRQYKDGALLLYKKPDSDFHFYWIKMGNNKVDMFATLENFYVEPKTYKVFYVDVFADFNPITLAQWRKWRN |
| A0A418Y750 | 3-100 | TREQAMSALMALPELKAWSAVIEKSSGGKARGALIEYDTKPRVINGKSYYQFSFVENSIDAAHPWESFLVAQQGDEILVDDFGTEKT… |
| C2M303 | 27-123 | None |
| L1P5S3 | 27-122 | None |
| A0A2M8TAY5 | 180-280 | None |
| A0A246GFW8 | 20-127 | None |
| A0A1H8TKV0 | 36-132 | None |
| A0A1T1C905 | 192-279 | None |
| A0A3S0N975 | 2-83 | None |
| A0A1V4XGA3 | 118-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.