DPCstruct | MC7020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 497 ± 44 aa |
| Standard deviation of domain lengths | 44.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q6TGT1 | 2-442 | QFSLVSTKTQAKAPFSLGFAFKRGDIPAGSTVGSSLSALQVTPRTTWPDGSLKFAQIAGFADLTANSLLTVRLRRIAASAGSAAVLT… |
| A0A418XUL8 | 1-583 | MIDNKRRTFLRTSSALAATGALTACGAGSSPEELGNQFASGVVFSEVPTPTGPGTGTAATVPGARFTVMSTTGQSSVPFCLGFAFRR… |
| A0A1Q2SL49 | 2-509 | None |
| A0A7C4HN02 | 2-476 | None |
| A0A2W7IM10 | 1-486 | None |
| A0A1V1P8U5 | 81-642 | None |
| A0A1Y5TPX4 | 237-746 | None |
| A0A4R3V444 | 1-458 | None |
| A0A7Y2G3T9 | 308-802 | None |
| A0A371RK58 | 320-771 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.