DPCstruct | MC702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 267 ± 61 aa |
| Standard deviation of domain lengths | 60.77 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.03 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0263- CL0426 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7MZB9 | 2-202 | TEDRSNVCVACGGDQYLTMHHVVPEMYRHWMPLVVKSKSSRDLLLLCKHCHDSYEQKATAFKKQGVKRFNIPLEGRGWISLPEHKRA… |
| A0A433CIX9 | 125-400 | PMQQHVLTQLTNSKKAEWYLSRALATRLSEDDVAIQLTFEPKGPGHEGDDYMIETRHNYCVCCGFTDDLTLHHVGGKSHIRRSIMLS… |
| H2YDP5 | 59-323 | None |
| A0A7S0CNG1 | 79-474 | None |
| U5ESD1 | 268-554 | None |
| A0A7S1SY78 | 206-577 | None |
| A0A2P6NMA0 | 247-457 | None |
| A0A1B0A486 | 97-289 | None |
| A0A034V8V6 | 1-181 | None |
| A0A1B0BNC1 | 262-491 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.