DPCstruct | MC7019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 129 ± 20 aa |
| Standard deviation of domain lengths | 19.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A852WGN1 | 8-110 | PGAGPSLCCDRCGQAAADPLQQILMSAVWLISGPDGPTTARYCRACPPVGPITDLTCLRCGDGPLLVGDLAADPSEPDDVLPAAARD… |
| J2JEB1 | 1-139 | MLKVPRTTVYGHLNKRQAIAPVTQEIIDPPAPTSRICPTCGPEPTTRAEAAHQRADLAVIWLYPDPDRRKTVIGRQHCRHCEPGQPA… |
| A0A1Q8LG76 | 1-143 | None |
| A0A1J0TX95 | 67-200 | None |
| A0A285E102 | 112-233 | None |
| A0A379JLR2 | 141-311 | None |
| A0A5B0HH23 | 1-110 | None |
| A0A6N7C7Z4 | 197-320 | None |
| A0A4R2K856 | 474-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.