DPCstruct | MC7017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 175 ± 16 aa |
| Standard deviation of domain lengths | 16.19 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z8Y9C3 | 65-244 | PPGVLWWLTFLFLSIYLMAASYAPGGFLIAEILGGFALVVAGGFYLLCLISSLLVHLRFGRIWWGARQLWWLVGPCIVLIGLLLIFL… |
| J1QXG5 | 263-465 | ERRPLMDGRDEQSAQHGPRHRTDTPRWWRLATGIVLTALVAFACAATLVITIPLDPVFPYVVLAGFALLILGAVWLILAGVQLWRFR… |
| A0A841D1Y0 | 6-189 | None |
| A0A438AT25 | 116-296 | None |
| A0A2A3I8L9 | 77-255 | None |
| A0A5M3XE07 | 27-208 | None |
| A0A098BGJ3 | 12-195 | None |
| A0A2Z3H9I9 | 4-166 | None |
| A0A251W8K0 | 3-158 | None |
| A0A3P3VXN3 | 14-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.