DPCstruct | MC7015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 196 ± 16 aa |
| Standard deviation of domain lengths | 16.25 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2E9W0 | 1-177 | MMKYQESFISIYIETDYLDGPLKEDDGSHSFHFEVGGKHISYGSPEHKALSEKYGDTHYNRLADIFKAALSRPLLSVDTEALDDYDE… |
| A0A3B9CRL4 | 18-227 | ISCTRSGSEVGGEFSETEYYIQGYLEADMLTGTVCTGGLIGLGFSGELYLPSRGEKGDKFRELSAFYGDTHYNKPTYPGGPNVLCNE… |
| A0A8B1ZS37 | 34-228 | None |
| A0A374ACI5 | 1-206 | None |
| C2MDV2 | 43-244 | None |
| R7F7B9 | 2-198 | None |
| A0A134BDE1 | 28-256 | None |
| C3JAT3 | 33-216 | None |
| R7EZC9 | 16-217 | None |
| C3J9Z0 | 19-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.