DPCstruct | MC7014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 157 ± 14 aa |
| Standard deviation of domain lengths | 13.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 13.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3XMX6 | 114-252 | SFILKREKNSNTGKTDLYYLDPARKEHYPLPKDRNGKDLQLAGIEVNSIEKLYQIELKIFSQEEIKYFGTNVSFADCIISSSGKIVS… |
| A0A358M0K6 | 13-176 | AGISYGQSIYQSIETVEADGITLTVKHTLHASLIYNSDYHYINESPWRYQDGREVETEEEYDSVSAQKNTAGELRALREVLGDDFIT… |
| A0A6S6M8S1 | 10-179 | None |
| A0A6I0DZI8 | 26-177 | None |
| A0A645FXD6 | 7-137 | None |
| A0A412WUX0 | 14-197 | None |
| A0A645IUJ6 | 2-145 | None |
| A0A5C6HMZ8 | 16-169 | None |
| A0A5C6HMV0 | 1-174 | None |
| C2FXV4 | 20-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.