DPCstruct | MC7013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 83 ± 15 aa |
| Standard deviation of domain lengths | 14.82 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16593 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847D4D4 | 4-89 | EYYLGLDIGTNSVGWAVTDLDYNLLRFNGKDMWGIRLFKEGQTAETRRIKRSARRRLERSKNRISLLQELFAEEISKVDPAFYQRL |
| A0A6G9Q899 | 7-79 | GEQVKYTLGLDIGTSSIGYAAIDKHQKPIRAKGKHVIGVRLFQEGKTAADRRAFRTTRRRLKRRKWRLNLLNR |
| A0A3F3H306 | 2-75 | None |
| A0A380JD47 | 14-126 | None |
| A0A1H9D582 | 3-70 | None |
| A0A0Q4IQB3 | 4-75 | None |
| F0K1W4 | 2-91 | None |
| Q7VG48 | 1-79 | None |
| A0A522UD60 | 3-66 | None |
| A0A7D8A916 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.