DPCstruct | MC7012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 260 ± 31 aa |
| Standard deviation of domain lengths | 30.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0AYX7 | 2-247 | KSEFYKQRFLWEHNIELVPQIKVSINIEQPYRTVLSELSSILKAVSETFAEFRYRNQFFTQNEYVEKLKCNLSPKYNAEKIASFILG… |
| A0A6G9Q2Q9 | 56-330 | IDLGKLWEERYNSLSFPDFKRQFFNNSLFDYDDKVTPKMQLKINYGEPGFDIVKNSFNEHLGRLSDLFLQIQRENGYHYFSLNYFKK… |
| A0A7T2CQN8 | 796-1092 | None |
| A0A0P0M2X9 | 140-394 | None |
| A0A563D5X7 | 21-265 | None |
| A0A829G792 | 86-379 | None |
| A0A7C1CUL7 | 782-1057 | None |
| R6A6W8 | 2-245 | None |
| A0A0R1F843 | 673-981 | None |
| A0A4Q2WGU5 | 95-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.