DPCstruct | MC7011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 92 ± 7 aa |
| Standard deviation of domain lengths | 6.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 50.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01510 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R1MX40 | 138-221 | REHSLDDFARSVNNDAHYVAYLLRQYNLPCTLADNTGSGTIWSHNAVSNYLGGTDHTDPVGYFAQWGYDMNQFYQLVQKKYNEL |
| D7UVP9 | 203-285 | RHKTFDEFARSINNYAYYAAYLLRQYNMPFDSAESDGKGTVWTHNAVTKYLGGTNHTDPVGYFSQWGYSVSQLNTLIKEKYDA |
| A0A7Z7QQH4 | 23-120 | None |
| X1XE89 | 17-115 | None |
| S4NHX9 | 85-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.