DPCstruct | MC7010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 178 ± 21 aa |
| Standard deviation of domain lengths | 21.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 19.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6EVP7 | 66-238 | IELHSNTLRRLALLELITSIRAHVKFDGLSSTALYILRKPDIEKLISRLLAMNSVCVLIRAHTLNFRCEHIESMEWEEAALQYFVRA… |
| A0A6C1SIA7 | 71-241 | GWQAMMTYVSACLEAGDHAALRAMGLGEAQVRRLAAMTMGELMRSEIAGEFGGRPMVRLHVDGDRLDAVLQSVERESARGRLIERCM… |
| A0A3S0F4D2 | 9-199 | None |
| A0A7C1Z665 | 28-204 | None |
| A0A2G2EUF0 | 87-260 | None |
| E1VKK6 | 51-218 | None |
| A0A6M4HDK1 | 1-179 | None |
| A0A3S4IKP5 | 1-139 | None |
| A0A699GH68 | 1-158 | None |
| A0A8A9EVP3 | 16-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.