DPCstruct | MC701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 187 ± 26 aa |
| Standard deviation of domain lengths | 25.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.14 |
| Pfam Score | 92.21 |
| Assigned Pfam label(s) | PF09169- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3NKH0 | 1-149 | METWGSKEAYQELKQYNINTNIVTEDWVVNHYKWIVWKIASMIRTENSLYEEYWNKEKIIEQLLFRYNKENNLRKHSALKLIIEKDN… |
| A0A3P3Y574 | 123-284 | GLSPAIATMTSRSAEFFQFDEIHGISKLMDDLVHQGARWDWISREWVSNHYRWVVWLLASLDRTFYGSIPVATTYERVLRKLLLRYD… |
| R7QAL5 | 88-288 | None |
| A0A0H2RWS6 | 105-308 | None |
| A0A2N1JEI3 | 264-435 | None |
| A0A653CNQ9 | 955-1169 | None |
| A0A397JED6 | 260-449 | None |
| A0A1V9Y7J5 | 556-749 | None |
| A0A197JNE7 | 2-176 | None |
| A0A287KAU5 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.