DPCstruct | MC7008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 201 ± 32 aa |
| Standard deviation of domain lengths | 31.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 13.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0004- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813DIB6 | 24-189 | SYTDGVNDQFLLDATRGRFTVMGEVFHYAEATKAGESEVDFVSRLLNAVRAATLPALLAPVTLAMSQSGLAALERASLCIAAVSGGS… |
| A0A7Y6JTB6 | 13-189 | QFLLHLSLFSHDKLFSQSLDIKRMNFVIQGSAITKEFINELHNKYDALVESKQYRKFAKEVFKEMFKYVEAQVPSDPILEELVTNCN… |
| A0A1Q9CMH7 | 2-174 | None |
| A0A7S2VKR9 | 11-238 | None |
| A0A4D6YBU8 | 244-423 | None |
| A0A454D1R1 | 173-336 | None |
| A0A4P8EXI5 | 12-189 | None |
| A0A6G0XYR8 | 170-324 | None |
| A0A6G0X4H9 | 930-1133 | None |
| A0A7S2RMG1 | 181-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.