DPCstruct | MC7005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 106 ± 21 aa |
| Standard deviation of domain lengths | 21.24 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.37 |
| Pfam Score | 93.50 |
| Assigned Pfam label(s) | CL0361- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9UJQ2 | 16-94 | KEQWVNFGGESDIKVLYESPYPDDIKSVPLFFICAYCLKPFSEQSSFFVHQDCCPRIAPPGREIYRESDSSLSFFEVDG |
| A0A0D6LB51 | 50-131 | KNIEWVVFGGYEIQCWYYSPYRLKKKAVERLYVCENCLLYTDDVRMYACHLAKDCERANPPGVLIYEEGDVQIYEVFGALQK |
| A0A0C2J6W6 | 255-365 | None |
| A0A814WK10 | 11-104 | None |
| A0A182U120 | 292-385 | None |
| A0A3Q0J2N5 | 72-187 | None |
| H2B2C1 | 154-236 | None |
| A0A7J6PPB3 | 79-221 | None |
| A0A834B8W7 | 17-94 | None |
| A0A368FEP8 | 15-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.