DPCstruct | MC7002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 64.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183CN21 | 38-122 | MKENGCFPEESKHTALKETLDFYFQLCSLEVNCEGAAVIAATLANGGVCPLTGERCIGSRPCRDVLSLMNSCGMYDYSGQFAFHV |
| A0A7S3D6K8 | 17-91 | FPEGTDLIETLNFYFMCCSLTLNARTMSVFAATLANGGVNPLTGKRIFQEATVRNCLSIALSCGMYDYSGQFAFR |
| A0A183P7N0 | 37-110 | None |
| F1L960 | 1-84 | None |
| A0A834AQT0 | 64-145 | None |
| A0A183QVA5 | 60-133 | None |
| A0A183JVZ5 | 1-88 | None |
| A0A4W4EVJ9 | 79-148 | None |
| A0A0C2CUQ4 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.