DPCstruct | MC7000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 128 ± 19 aa |
| Standard deviation of domain lengths | 19.48 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835PAU7 | 42-144 | LYETRNLNKASCCVCCFKVFYYLGELNDSLSYALGAGPLFDVSEDSDYAHTLLAKALDEYASLRAKNAKSNEVASAIDPRLEAIVER… |
| A0A183DYP7 | 22-160 | FEVADYLSVIEGLHENENFSERHRAALLASKVAYCLGDYNGALNLALAAEDKFQLTPRPSSVLVGSQDEQYVNKIIEHALDTYKKAK… |
| A0A812S905 | 412-549 | None |
| A0A7E4RYR5 | 2-107 | None |
| A0A183MXF4 | 57-184 | None |
| W2T8R0 | 109-277 | None |
| X6MLE9 | 11-141 | None |
| A0A0V1Q0K8 | 49-164 | None |
| A0A565AMC1 | 42-174 | None |
| R4XB38 | 45-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.