DPCstruct | MC700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 94 ± 21 aa |
| Standard deviation of domain lengths | 20.79 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 75.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1KXC4 | 1-64 | MFVYDYFKRNSVHWGILDFLNNFTEKPFKLKIDSYLKVLEIIMNSEQGKRRNKAKLLNDDYKKA |
| A0A433BAU6 | 12-94 | RIHEYFNRRPAQWCILGFLNECDMEPFERKMDEYLKSLSNIIDCEQGIRHERAKCLLDRYRKVKKNGGVTGTSSVPVIQDSSS |
| A0A433Q1J5 | 23-111 | None |
| A0A433QB96 | 3-116 | None |
| A0A372Q6N4 | 4-81 | None |
| A0A372QCQ1 | 5-93 | None |
| A0A2Z6RSG7 | 1-99 | None |
| U9T567 | 2-69 | None |
| A0A397IVQ0 | 40-152 | None |
| A0A2N0RVU6 | 7-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.