DPCstruct | MC70
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9QBD2 | 2-74 | GGRSGSTVVGAYAFDVNFKGSQAEAYRSNIVLRPKASEVFAAGVTAIEQISGCRVAPNSVRGDVAMVQAEILC |
| A0A2V2LFT0 | 18-109 | SALAGCDTPSPPMFGADRTRVSVSGQDFTVRHDRMRAESVRTSPMADPGLRDMLLMSRAAIEAASGCPVRSGTLYGDRVMAEAFLDC… |
| A0A2E3GZ70 | 27-122 | None |
| A0A2G4J6A3 | 3-104 | None |
| A0A6I1EMH4 | 13-97 | None |
| A0A2A4N994 | 8-113 | None |
| A0A4R2P0K4 | 12-98 | None |
| A0A832J0H7 | 12-97 | None |
| A0A545SN34 | 3-76 | None |
| A9DVT0 | 34-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.