DPCstruct | MC7
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 79 ± 4 aa |
| Standard deviation of domain lengths | 3.96 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 57.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4EIK3 | 1-75 | LYGLPDGRATCRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKK |
| A0A6Q2WUX3 | 27-106 | IPNIDPILNANTVCLTLPGLNRRQLDVCMRNPDVTASAIQGIQIAIHECQHQFRGHRWNCSSLETRNKIPYDSVVFKRGF |
| A0A7R9DXI4 | 120-200 | None |
| E9IYT9 | 1-85 | None |
| A0A7N5JQP3 | 53-125 | None |
| A0A4W5Q945 | 25-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.