DPCstruct | MC6998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 201 ± 21 aa |
| Standard deviation of domain lengths | 21.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D1UKU4 | 96-311 | MYGAVLLGNAVLQFILTKFTKDPETVHPCLLFHRVITNVVLLIAMIDVQLFSKAWSHEHVTFGMLGAFLWALGSLVHLVRGGYPGGH… |
| A0A2G9U8R5 | 3-185 | VFQCRSMTPELILPRYLEIAKNLLFAGLIFNVSLLIGSGWHIGTALLPSYRIGNCLYQLDAIASICIGIAWLTFPKWLLHRQVVIPL… |
| A0A812CJZ9 | 264-486 | None |
| A0A1S3K8D2 | 3-185 | None |
| A0A3P8FDK1 | 35-206 | None |
| A0A2H2I479 | 4-203 | None |
| A0A090L9G9 | 17-195 | None |
| A0A3P7DZ87 | 2-230 | None |
| A0A7I8VB72 | 76-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.