DPCstruct | MC6996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 75 ± 15 aa |
| Standard deviation of domain lengths | 14.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.79 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF01683- PF14625 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5M641 | 455-523 | AEDCNEEQILVDGECLKRASPNDLCKSSAQCMGGSICSGDICKCPNGTKLVGKFCQIIPACMDGQLQVG |
| A0A1B0D0Q7 | 134-199 | KCRPGYHQSTNGACFVSVEVGGICEVDENCSLDPFSLCQEGRCVCMEGLVNINGECSSSSIPSLPT |
| A0A0N4TBF9 | 1-74 | None |
| A0A0B1TGH4 | 253-335 | None |
| A0A0K0FEB1 | 1-109 | None |
| A0A0D8Y922 | 54-139 | None |
| A0A0M3KFF5 | 101-181 | None |
| W2TCF0 | 15-80 | None |
| A0A3P8AAK8 | 198-257 | None |
| A0A0V1HBT9 | 161-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.