DPCstruct | MC6995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 232 ± 23 aa |
| Standard deviation of domain lengths | 22.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1RR25 | 126-364 | QDFSSLSVPSSPFLVALFLCDAELSWAMACPNRLLLRLGLKYSWYPTPIVNIVGREAAYTTETSQTVLKVFTDFRNWSFRMKHVVGC… |
| A0A2G9U737 | 86-308 | SSLSLPNSPFLIALFLNDAEVPWAMACPNRLLFRLGLKYSWYPTPFVNIVGRQAVYSTETSQTVLKVFTDFRSWSFRMKHLAGSTVT… |
| A0A6L5CM16 | 137-355 | None |
| A0A654HT31 | 547-799 | None |
| A0A0M3IRC4 | 4-244 | None |
| A0A1I8F2S8 | 549-787 | None |
| A0A3C0T8N9 | 2-187 | None |
| C1H884 | 217-440 | None |
| A0A1L8E309 | 731-983 | None |
| A0A4Z2B6E1 | 486-673 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.