DPCstruct | MC6994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 156 ± 7 aa |
| Standard deviation of domain lengths | 7.45 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.54 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0220- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9U2P9 | 1-164 | MTSIPESIAQTHNFFKTLTGTEHIQFSRLSEEELVKKLRDLGVKGDSEQIRDWFKSVDFDGDGYVDYHGWSKILEDHIQLGSMFKIL… |
| A0A812KQ06 | 227-380 | MSTCLGEICRLYKRLSHDDEVSEPFYAIDRSFKMDFETFKTGWLKMFEGKTEAELKSMFETMDTDGDGQISYLEWSSSVKLSEINEL… |
| A0A6S7HBQ2 | 71-222 | None |
| A0A7J6QNL9 | 1-166 | None |
| A0A024USP9 | 436-583 | None |
| A0A0K0EE58 | 632-784 | None |
| A0A4V6APY7 | 263-429 | None |
| A0A7J6NPY8 | 501-645 | None |
| A0A812T5D5 | 128-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.