DPCstruct | MC6992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 145 ± 15 aa |
| Standard deviation of domain lengths | 15.48 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9TX06 | 1-142 | MPEVILQGNSEPTDDSRKRKAQQPEGDEGIYWRINWTRFDRYIRDEMTLELLVPKGSAGEYTAHCLSQTVRSLLKANEVRVSPVATI… |
| A0A0J7L561 | 22-152 | NKLYWQVNFDRFTQDFRDKIVISAMTQRFDNNAGELMRQLINLMYLRTASWEATSNPIPYTEIKEEIKKLNYSELEQYLAEYLRLIE… |
| A0A820UEQ2 | 779-906 | None |
| A0A1L2FUQ1 | 212-395 | None |
| A0A834DE19 | 26-152 | None |
| A0A7R9FWI1 | 2-156 | None |
| A0A3Q3A5A0 | 210-337 | None |
| A0A674GAT7 | 389-539 | None |
| A0A0A9A2X4 | 1-148 | None |
| A0A843XV84 | 297-451 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.