DPCstruct | MC6990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 167 ± 25 aa |
| Standard deviation of domain lengths | 25.36 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.17 |
| Pfam Score | 94.17 |
| Assigned Pfam label(s) | PF08619- CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0HJ28 | 60-186 | KIDEAVNRLVVLPLFTALGAMLPWREWGELGWWRALLLVVGVLLLRRLPVLLILKRPLSLTWRDTVFLGWFGPLGVSALFYLTMEAH… |
| A0A5M9K6C0 | 1-181 | MFVYFGSIIPWDQFQPSSITPHVKPWTLTLFLILVLLFRRIPILLLTKSLIPDIRTYHEALFAGHFGPMGVGALFLVMEARAQLETG… |
| A0A6A5VAG0 | 7-149 | None |
| A0A5M3MVZ4 | 739-918 | None |
| A0A167DQ17 | 2-137 | None |
| A0A0L0SRY3 | 481-665 | None |
| A0A4T0NFJ1 | 186-351 | None |
| A0A0G2E985 | 64-230 | None |
| O14123 | 305-469 | None |
| A0A077WAI0 | 35-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.