DPCstruct | MC699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 433 ± 40 aa |
| Standard deviation of domain lengths | 40.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015JLS8 | 1-371 | MLVNLSDQIKTEINNQIKDDIPLHPIVVESTTNQSFVTRRLIKKNSFEPSALFVFKEEFPTDLKNKLKDHYLRIDRKKMDMKALRLF… |
| A0A433AT57 | 1-466 | MQAHGHPDDVDSFKWKDEDTLEDFMEDNESDTNCFEFEVQKNQEQKEDFTFREGFKASFSLVVSIHIRIAGSKDRYECCETHIDLDL… |
| A0A2N0S1D5 | 193-612 | None |
| A0A2N0Q569 | 1-452 | None |
| A0A1J8PYD7 | 299-778 | None |
| A0A2N0QXP1 | 159-591 | None |
| A0A0W8DG95 | 135-522 | None |
| A0A0C3AK11 | 56-523 | None |
| A0A6G0Q988 | 199-572 | None |
| A0A1J8QXU9 | 2-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.