DPCstruct | MC6989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 145 ± 21 aa |
| Standard deviation of domain lengths | 20.67 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M9K3I0 | 1-136 | MRSYKKPEEVFDKTGKLLPELKELAPIGNARMSANPVGNGGILRKPLDIPDFRKYAFENIEPGVSNLPSMSNMAKLLRDVVAKNMHT… |
| X8AUE6 | 53-183 | RSYRPQELFDTNGTLRAELRALAPNGNRRMSANPHANGGLLLRDLDLPDFRDYAVDVSRPATLTHEATKVLGTFLRDVIARNRDRFR… |
| A0A2P9IAH4 | 213-373 | None |
| A0A6G3V8H9 | 36-172 | None |
| A0A0D2EBX5 | 187-292 | None |
| A0A2R5HE69 | 186-356 | None |
| A0A449A3D7 | 108-237 | None |
| K2PFW1 | 240-403 | None |
| A0A8B3HHA1 | 2-118 | None |
| A0A1V8UTK8 | 714-877 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.