DPCstruct | MC6988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 160 ± 22 aa |
| Standard deviation of domain lengths | 22.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2ZZV9 | 76-248 | NVYTRRLVAEASAKACWICFKPSSTVLINEDQDFFYICPGHLTDPKFATAKDAEDLAKKKKDEEIEKEIEAVKKEFAEKMRKKMDRR… |
| A0A5M9K063 | 6-149 | NIWTHRKVAETASKPCEICYKPSASVLITPENKDFFYVCPSHLKDKGFATPIIDEAALAAKKKKEMDDEIERVKQEFEEKQKRKKQK… |
| H0EQN3 | 1-135 | None |
| A0A420Q319 | 2-144 | None |
| A0A1Y2G452 | 11-216 | None |
| A0A427YXA5 | 366-537 | None |
| U7PW77 | 1-137 | None |
| Q6C8I9 | 1-155 | None |
| A5AAJ9 | 4-201 | None |
| A0A0N1HDB2 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.