DPCstruct | MC6986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 155 ± 26 aa |
| Standard deviation of domain lengths | 25.91 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0USL7 | 344-507 | LRHLSALTLESFKPNSKTTGADYAFTDSVRGRARRCLPGCTNPSCCGGVALKAVQMGGYHGADDTDAEVLEKHFGENWAAIIAAYPP… |
| A0A1U7LT70 | 4-143 | TDTRPDELDTTDFIVNPARNNGINYAYHEVVRGKEARKALHAHDCPCCKTFYDIAGPPPPSMAPRWRSHSPESNDVIQKVSRHRVNF… |
| K5WXW1 | 111-296 | None |
| A0A1E4S6P2 | 6-145 | None |
| T0K2Q0 | 170-354 | None |
| A0A1Y2CIP2 | 125-256 | None |
| A0A5N6XPK1 | 494-661 | None |
| A0A2T0FGT7 | 133-263 | None |
| A0A1Y1XVK7 | 153-245 | None |
| A0A7D8UZJ8 | 19-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.