DPCstruct | MC6985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 197 ± 54 aa |
| Standard deviation of domain lengths | 54.27 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08624 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7LT39 | 2-202 | DFDDSKGDSPLTEFEEDSEDEQIRVKRRERKPSEAIENVASSSLQTIKQDPDEHSISDIDEAGESKITEDGDLLSGREFKVRTFKFL… |
| A0A1E4S0K4 | 329-479 | VKAPTFTDNKMLTPTKDDYVYTKTSEKGETKVTKNGHLLGGRSYIFSTFTLPGRGKKLYVLAAEAARTLGVRDAFILCARLKQLCRH… |
| B6K5G9 | 1-212 | None |
| A7A1Z0 | 72-224 | None |
| I2H0E4 | 65-214 | None |
| A0A433Q7H9 | 276-467 | None |
| Q6FLW5 | 53-206 | None |
| A0A066W213 | 406-615 | None |
| R4XCY1 | 167-363 | None |
| Q5KPC5 | 258-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.