DPCstruct | MC6982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 144 ± 15 aa |
| Standard deviation of domain lengths | 14.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194XF79 | 54-199 | QEGHEALTCENPRKINRDHVKDVSGEVAWEALRAAVLDHDLDDLKEAAEQYIKANPDTTYLTLEKAFRSQGLGVYLIAIEKELGITY… |
| A0A1U7LLV8 | 61-186 | VPKNDGIPILSAEEAWAELVKADEAKDSDDVQFAFDIYSKACPQESFQEIETKLRNANMNTRLVSLKKEEIPANKIILNNKNEEVEF… |
| A0A6C0CA58 | 2-138 | None |
| A0A6H0XIW0 | 97-216 | None |
| A0A1X2H855 | 701-829 | None |
| A0A0F9XTC5 | 122-280 | None |
| A0A6A6SBY5 | 8-133 | None |
| A0A225ASU3 | 848-1024 | None |
| A0A084G065 | 112-275 | None |
| D4AVA1 | 2-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.