DPCstruct | MC6981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 8.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6ZF19 | 360-466 | DFVQPANFTTFATPHVGASVKVFGGIDNLIDNFVSQRLSATGQQLFLVDDHLGTGKPLLYLLAERDSTFDQGLSCFQWFAAYGNITG… |
| A0A1Q3ELZ5 | 11-115 | VSGVNFNTIATPHFGLVKYNSFFSAISRILGPKLLSRTGEQFYCVDKWGKSGRPLLDVMSDPNLIFFQSMAQFKHVRIYANALNDLT… |
| A0A7R7WNZ3 | 25-141 | None |
| J3MBD5 | 33-138 | None |
| A0A024UCP0 | 181-295 | None |
| I1BIM5 | 1-103 | None |
| A0A367KT59 | 732-820 | None |
| A0A540MIG0 | 157-281 | None |
| A0A1X0RRV1 | 66-184 | None |
| A0A250XKV6 | 119-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.