DPCstruct | MC6980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 368 ± 33 aa |
| Standard deviation of domain lengths | 32.86 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.56 |
| Pfam Score | 51.67 |
| Assigned Pfam label(s) | PF00621- PF12015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9HF61 | 7-380 | DEVGRELRVATGTSLIEYPVKDWLLRRQPTEWEALLGEAAIFSGQDELLWGPFVACVYREPRTTRLNCLFMDRIGVMHLHSVDVSDT… |
| A0A1U7LIZ6 | 1-367 | MCPLLLSEWRVSLPLHGHEFFFADDALIGPLLIALPLDNSRSAAVFALCGSLSIPNLSLSPNGPFFPAAQHLPPSLFENLHIRALAV… |
| A0A0L8VVY7 | 1-396 | None |
| A0A0J9XKE3 | 18-370 | None |
| D4AJC0 | 16-424 | None |
| A7F850 | 3-318 | None |
| G8YL63 | 41-441 | None |
| A0A093W2P5 | 9-407 | None |
| A0A0F8D9W7 | 8-321 | None |
| U1FU78 | 7-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.