DPCstruct | MC698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 122 ± 8 aa |
| Standard deviation of domain lengths | 7.68 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433AT20 | 1-137 | MERFCNDVVPGSFRSLTDVDYTKLCKLCMHYIGVYGNPVMIAQLLHNVGAISTETLQTLREQCEAPYDSRQELAPMNAGIYLYHHKP… |
| A0A0C3LC77 | 209-333 | NALRDGSYKTISKINFAALDGVSINPVGLYGSKSALTQTLVTLGAVEESIAEHLRQPINRNGQLSPYLRSGIYLFLPPVPDSDAQTA… |
| U9TV20 | 64-178 | None |
| A0A1J8PYD7 | 161-280 | None |
| A0A2N0S1D5 | 50-167 | None |
| A0A5C3PVP4 | 1-112 | None |
| A0A2I1EUL2 | 73-190 | None |
| K5V904 | 194-306 | None |
| A0A0C3B065 | 96-218 | None |
| A0A0C3A5A1 | 110-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.