DPCstruct | MC6979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 126 ± 20 aa |
| Standard deviation of domain lengths | 19.95 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9H3C6 | 10-108 | LLILIAITSFASAYETYCKCQCGQDYAIYTLEHKQTCRDCNASFCLSKGSVLCSGKTKDEAKKEIITSCFQRESTRDMLVIYGFMIL… |
| A0A1U7LHK2 | 8-121 | FLVSLFLIIHMVSADLSLSYCKCICSKNSTIIPLTDPIDPVKPCNQCTRKFCLDYNLPACTAMTDQEEITTICFQRESRKDKAIIIM… |
| A0A1X2IET7 | 2-94 | None |
| M9LUP2 | 474-602 | None |
| A0A4V3SJM7 | 16-147 | None |
| A0A0S7E874 | 106-241 | None |
| A0A0J0XLU2 | 3-120 | None |
| A0A232M1H2 | 1-156 | None |
| N1JEG2 | 8-125 | None |
| A0A135LYA5 | 31-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.