DPCstruct | MC6978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 284 ± 32 aa |
| Standard deviation of domain lengths | 32.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3AJX0 | 2-270 | AAELLKVAGLESETGDSQVTLDAYSIINKSTSAPLASLILHLVESVILDTEWVIMKLKIYSLPNTRAVLVNQNGEKDTRLALEETVY… |
| D8LV66 | 77-320 | MMPICQSVGTKEGIHCAHFASITDSNASNVAIALSDAIQTLLRPLSFMISLHKMYSVKNELEQERIRHLVPSFYSAWKKSAAHLCDA… |
| A0A820SWH6 | 4-256 | None |
| I0YJP1 | 455-708 | None |
| S9WF36 | 573-832 | None |
| A0A2J7PG45 | 362-692 | None |
| A0A7J8CG00 | 13-302 | None |
| A0A482VIV3 | 134-454 | None |
| A0A0C2DPZ6 | 53-373 | None |
| A0A1I8IXM5 | 9-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.