DPCstruct | MC6977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 118 ± 15 aa |
| Standard deviation of domain lengths | 14.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0E2M9 | 72-189 | SNISIEDIILQTIKVDVKSIKQCCEGEITDIRSNDEYIEVDLMTTKESRTIRLNKNIQYQLENIFIGDILYAEPTMGVVRKLGRSEN… |
| A0A2G3AIE4 | 30-131 | AEVIEGEVVEVQFDRSALKTSNLTSKTTDMEMVYDFRAKMIEALGKKKVQSGDVIGIDKASGEITKLGMSFSRSRDYDAMGLQTKFV… |
| A0A2H3CM59 | 116-209 | None |
| Q98RS5 | 102-200 | None |
| A0A4Y7JJY3 | 539-654 | None |
| A0A842YPJ4 | 65-176 | None |
| A0A1J8Q188 | 527-640 | None |
| A0A0N4W949 | 815-923 | None |
| A0A4Y7JGL6 | 632-785 | None |
| A0A7J9J751 | 28-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.