DPCstruct | MC6976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3AF52 | 1-112 | MTVIFFAKQGKDCSLAPMKESLPPITFEFQKGFTQKFRQAFGIGIDFSMFEEAELSKDGEANVYPLAVKAEATLDSQSGAEDGNAAS… |
| A0A7J8WDS8 | 85-185 | TVMFFAKEGEDCKLTPMKENMQPSVTVPFEQGTGQKFQQPPGSGISFFMFEESELLHVGEAGIYPLAVKAEAFPANSNDGSQNTQIT… |
| A0A2G3BUD1 | 62-174 | None |
| A0A498IKG6 | 168-275 | None |
| A0A6P3ZJJ9 | 307-417 | None |
| A0A7J8LYS8 | 38-181 | None |
| A0A3Q7EP81 | 29-140 | None |
| A0A7G2ENM4 | 91-200 | None |
| A0A2Z7BS30 | 158-265 | None |
| A0A6P5RTS9 | 473-584 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.