DPCstruct | MC6975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 60 ± 3 aa |
| Standard deviation of domain lengths | 2.83 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 50.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6D8S9 | 10-64 | DHSTSVKAKLNNHGTLGALLQHEVLPKSVVTVSSEIDTKALDKHPRFGLSLALKP |
| A0A2G3ACK3 | 19-76 | KHQLDEVTTVEARLNNFGKATALFQRERPNFVLTLSGEIDTKALNKGAKFGWAVKMMG |
| A0A4S4EF19 | 252-317 | None |
| A0A446U8C1 | 216-274 | None |
| A0A2P5XV74 | 325-383 | None |
| A0A816K1C7 | 543-601 | None |
| A0A1R3IA83 | 8-67 | None |
| A0A2U1PD92 | 428-486 | None |
| D7SIG0 | 200-258 | None |
| A0A7C9CWS9 | 63-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.