DPCstruct | MC6974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 418 ± 109 aa |
| Standard deviation of domain lengths | 108.59 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 79.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497GWY5 | 24-478 | SWDRALVVGHRDADGVTATAIALRTLEAMGIEAGYEIVQELSSQVLASLASRSVPIWFVDIGAGWLPQLRGLRFVLTDHHPPREAEI… |
| A0A2G3A7I5 | 2-442 | VREQSIESFYTRLRDSALASASTSPLLVFPSTSDVDSLCALKIIGHVLESDSVRYACYPVSSFKEIYKYTGDNLGPAADEPITILLI… |
| A0A2A4K7M8 | 1-525 | None |
| A0A835APH1 | 452-836 | None |
| L1K0Q3 | 270-702 | None |
| A0A1V9ZXW5 | 2-602 | None |
| D3BKP9 | 161-765 | None |
| A0A183H3U7 | 15-398 | None |
| A0A6L5CT05 | 18-310 | None |
| A0A1R4ABD1 | 1-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.